Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Western blot analysis of various lysates using Aromatase (CYP19A1) Rabbit pAb (A12684) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Human placenta using Aromatase (CYP19A1) Rabbit pAb (A12684) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat ovary using Aromatase (CYP19A1) Rabbit pAb (A12684) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
| Product name | Aromatase (CYP19A1) Rabbit pAb |
|---|---|
| Catalog No. | A12684 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human Aromatase (CYP19A1) (NP_000094.2). |
|---|---|
| Sequence | MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM; Aromatase (CYP19A1) |
| Calculated MW | 58kDa |
| Observed MW | 48kDa |
| Reactivity | Human, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, Rat brain |
| Cellular location | Membrane, Peripheral membrane protein. |
| Customer validation | IF(Danio rerio, Mus musculus, Gallus gallus) WB(Homo sapiens, Rattus norvegicus, Mus musculus, Capra hircus, Other) IF(Homo sapiens) IHC(Mus musculus) RT-PCR(Gallus gallus) IHC(Homo sapiens) WB(Gallus gallus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12684? Please let us know so that we can cite the reference in this datasheet.
