제품 > 항체 > 다중클론항체(pAb)

BAF60a Rabbit pAb (A9950)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using BAF60a Rabbit pAb (A9950) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunohistochemistry - BAF60a Rabbit pAb (A9950)

Immunohistochemistry analysis of paraffin-embedded Rat brain using BAF60a Rabbit pAb (A9950) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using BAF60a Rabbit pAb (A9950) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse brain using BAF60a Rabbit pAb (A9950) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	BAF60a Rabbit pAb
Catalog No.	A9950
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable several functions, including chromatin binding activity; molecular adaptor activity; and transcription coregulator activity. Predicted to be involved in epigenetic maintenance of chromatin in transcription-competent conformation; nucleosome disassembly; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within chromatin organization and nervous system development. Part of SWI/SNF complex; nBAF complex; and npBAF complex. Is expressed in several structures, including central nervous system; dorsal root ganglion; early conceptus; genitourinary system; and retina layer. Human ortholog(s) of this gene implicated in Coffin-Siris syndrome. Orthologous to human SMARCD1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of mouse BAF60a (NP_114030.2).
Sequence	MAARAGFQSVAPSGGAGASGGAGVAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRN
Gene ID
Swiss Prot
Synonyms	Baf60a; D15Kz1; BAF60a
Calculated MW	58kDa
Observed MW	58kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SH-SY5Y, 293T, HepG2, BT-474, K-562, Mouse brain, Rat testis
Cellular location	Nucleus