제품 > 항체 > 단일클론항체(mAb)

BCL2L14/BCLG Rabbit mAb (A19292)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using BCL2L14/BCLG Rabbit mAb (A19292) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - BCL2L14/BCLG Rabbit mAb (A19292)

Immunohistochemistry analysis of BCL2L14/BCLG in paraffin-embedded mouse kidney tissue using BCL2L14/BCLG Rabbit mAb (A19292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of BCL2L14/BCLG in paraffin-embedded human colon tissue using BCL2L14/BCLG Rabbit mAb (A19292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of BCL2L14/BCLG in paraffin-embedded mouse testis tissue using BCL2L14/BCLG Rabbit mAb (A19292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of BCL2L14/BCLG in paraffin-embedded rat testis tissue using BCL2L14/BCLG Rabbit mAb (A19292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of BCL2L14/BCLG in paraffin-embedded Human lung adenocarcinoma tissue using BCL2L14/BCLG Rabbit mAb (A19292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of BCL2L14/BCLG in paraffin-embedded rat kidney tissue using BCL2L14/BCLG Rabbit mAb (A19292) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Overview

Product name	BCL2L14/BCLG Rabbit mAb
Catalog No.	A19292
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2474

Background

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human BCL2L14/BCLG (Q9BZR8).
Sequence	MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTIT
Gene ID
Swiss Prot
Synonyms	BCLG; BCL2L14/BCLG
Calculated MW	37kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A549, BxPC-3, Mouse large intestine, Mouse testis, Mouse stomach, Rat testis
Cellular location	Cytoplasm, Endomembrane system, cytosol