제품 > 항체 > 다중클론항체(pAb)

BTAF1 Rabbit pAb (A5811)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using BTAF1 Rabbit pAb (A5811) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

ABclonal:Immunoprecipitation - BTAF1 Rabbit pAb (A5811)

Immunoprecipitation analysis of 150 μg extracts of HeLa cells using 3 μg BTAF1 antibody (A5811). Western blot was performed from the immunoprecipitate using BTAF1 antibody (A5811) at a dilution of 1:500.

ABclonal:Chromatin Immunoprecipitation - BTAF1 Rabbit pAb (A5811)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using BTAF1 antibody (A5811) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	BTAF1 Rabbit pAb
Catalog No.	A5811
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a TAF (TATA box-binding protein-associated factor), which associates with TBP (TATA box-binding protein) to form the B-TFIID complex that is required for transcription initiation of genes by RNA polymerase II. This TAF has DNA-dependent ATPase activity, which drives the dissociation of TBP from DNA, freeing the TBP to associate with other TATA boxes or TATA-less promoters.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1600-1849 of human BTAF1 (NP_003963.1).
Sequence	LAVQNSSLHDIQHAPKLSALKQLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK
Gene ID
Swiss Prot
Synonyms	MOT1; TAF172; TAFII170; TAF(II)170; BTAF1
Calculated MW	207kDa
Observed MW	250kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HepG2, HeLa, MCF7, Rat testis
Cellular location	Nucleus.