Reviews (2)Publications (16) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from THP-1 cells, using Bak Rabbit pAb (A0204) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of C6 cells using Bak Rabbit pAb (A0204) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using Bak Rabbit pAb (A0204) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of THP-1 cells using 3 μg Bak antibody (A0204). Western blot was performed from the immunoprecipitate using Bak antibody (A0204) at a dilution of 1:1000.
| Product name | Bak Rabbit pAb |
|---|---|
| Catalog No. | A0204 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Bak (NP_001179.1). |
|---|---|
| Sequence | EGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF |
| Gene ID | |
| Swiss Prot | |
| Synonyms | BAK; CDN1; BCL2L7; BAK-LIKE; Bak |
| Calculated MW | 23kDa |
| Observed MW | 25kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | THP-1 |
| Cellular location | Mitochondrion membrane, Single-pass membrane protein. |
| Customer validation | (HeLa cells) WB(Homo sapiens, Gallus gallus, Mus musculus, Other, Mus musculus) IF(Homo sapiens, Gallus gallus) ELISA(Homo sapiens,Mus musculus,Oryctolagus cuniculus) IF(Homo sapiens,Mus musculus,Oryctolagus cuniculus) IP(Homo sapiens,Mus musculus,Oryctolagus cuniculus) WB(Homo sapiens,Mus musculus,Oryctolagus cuniculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0204? Please let us know so that we can cite the reference in this datasheet.
![[KD Validated] Bak Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A23523/A23523_1.jpg?t=1733905324)
