Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | BiP/GRP78 Rabbit mAb |
---|---|
Catalog No. | A23453 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54734 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 531-630 of human BiP/GRP78(NP_005338.1). |
---|---|
Sequence | NRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPI |
Gene ID | |
Swiss Prot | |
Synonyms | BIP; GRP78; HEL-S-89n; BiP/GRP78 |
Calculated MW | 72kDa |
Observed MW | 78kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | U-87 MG, Jurkat, NIH/3T3, Mouse placenta, PC-12 |
Cellular location | Cytoplasm, Endoplasmic reticulum lumen, Melanosome. |
Customer validation | WB(Homo sapiens, Mus musculus, Other) IF(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23453? Please let us know so that we can cite the reference in this datasheet.