Reviews (2)Publications (12) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | BiP/GRP78 Rabbit pAb |
---|---|
Catalog No. | A11366 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 550-654 of human BiP/GRP78 (NP_005338.1). |
---|---|
Sequence | EEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL |
Gene ID | |
Swiss Prot | |
Synonyms | BIP; GRP78; HEL-S-89n; BiP/GRP78 |
Calculated MW | 72kDa |
Observed MW | 72kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HepG2, U-87MG, Mouse liver, Rat liver, Rat testis |
Cellular location | Cytoplasm, Endoplasmic reticulum lumen, Melanosome |
Customer validation | (Human renal epithelial cell line, Pheochromocytoma in mice) WB(Homo sapiens) IHC(Rattus norvegicus, Homo sapiens, Mus musculus) WB(Homo sapiens,Mus musculus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A11366? Please let us know so that we can cite the reference in this datasheet.