제품 > 항체 > 다중클론항체(pAb)

Brachyury Rabbit pAb (A16887)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from H460 cells, using Brachyury Rabbit pAb (A16887) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Brachyury Rabbit pAb (A16887)

Immunofluorescence analysis of NCI-H460 cells using Brachyury Rabbit pAb (A16887) aBrachyury diluBrachyuryion of 1:200 (40x lens). Blue: DAPI for nuclear sBrachyuryaining.

Overview

Product name	Brachyury Rabbit pAb
Catalog No.	A16887
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. Variation in this gene was associated with susceptibility to neural tube defects and chordoma. A mutation in this gene was found in a family with sacral agenesis with vertebral anomalies.

Immunogen information

Immunogen	RecombinanBrachyury fusion proBrachyuryein conBrachyuryaining a sequence corresponding Brachyuryo amino acids 226-435 of human Brachyury (NP_003172.1).
Sequence	HKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQGRLIASWTPVSPPSM
Gene ID
Swiss Prot
Synonyms	T; TFT; SAVA; Brachyury
Calculated MW	47kDa
Observed MW	47kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	H460
Cellular location	Nucleus.
Customer validation	WB(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Brachyury Rabbit pAb images

Western blot - Brachyury Rabbit pAb (A16887)

Immunofluorescence - Brachyury Rabbit pAb (A16887)

Immunofluorescence analysis of NCI-H460 cells using Brachyury Rabbit pAb (A16887) aBrachyury diluBrachyuryion of 1:200 (40x lens). Blue: DAPI for nuclear sBrachyuryaining.

* For research use only. Not for therapeutic or diagnostic purposes.