제품 > 항체 > 다중클론항체(pAb)

CASP1 Rabbit pAb (A20470)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of extracts of Mouse testis, using CASP1 antibody (A20470) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	CASP1 Rabbit pAb
Catalog No.	A20470
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables cysteine-type endopeptidase activity. Involved in several processes, including positive regulation of I-kappaB kinase/NF-kappaB signaling; positive regulation of interleukin-1 beta production; and protein autoprocessing. Acts upstream of or within several processes, including membrane hyperpolarization; mitochondrial depolarization; and positive regulation of interleukin-1 alpha production. Located in extracellular region. Part of IPAF inflammasome complex. Is expressed in knee joint and metanephros. Orthologous to human CASP1 (caspase 1).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse CASP1 (NP_033937.2).
Sequence	KVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
Gene ID
Swiss Prot
Synonyms	ICE; Il1bc
Calculated MW	46kDa
Observed MW	48kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse testis
Cellular location	AIM2 inflammasome complex, cytoplasm, cytosol, extracellular region, extracellular space, inflammasome complex, IPAF inflammasome complex, mitochondrion, neuron projection, NLRP1 inflammasome complex, NLRP3 inflammasome complex, nucleus, plasma membrane