Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | CASP1 Rabbit pAb |
---|---|
Catalog No. | A20470 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse CASP1 (NP_033937.2). |
---|---|
Sequence | KVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD |
Gene ID | |
Swiss Prot | |
Synonyms | ICE; Il1bc |
Calculated MW | 46kDa |
Observed MW | 48kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse testis |
Cellular location | AIM2 inflammasome complex, cytoplasm, cytosol, extracellular region, extracellular space, inflammasome complex, IPAF inflammasome complex, mitochondrion, neuron projection, NLRP1 inflammasome complex, NLRP3 inflammasome complex, nucleus, plasma membrane |
Customer validation | WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20470? Please let us know so that we can cite the reference in this datasheet.