Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CCL21 Rabbit pAb |
---|---|
Catalog No. | A1896 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-134 of human CCL21 (NP_002980.1). |
---|---|
Sequence | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
Gene ID | |
Swiss Prot | |
Synonyms | ECL; SLC; CKb9; TCA4; 6Ckine; SCYA21; CCL21 |
Calculated MW | 15kDa |
Observed MW | 15kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Recombinant Human CCL21 Protein |
Cellular location | Secreted. |
Customer validation | WB(Cynoglossus semilaevis, Homo sapiens, Mus musculus , Other, Rattus norvegicus) IF(Mus musculus) ELISA(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1896? Please let us know so that we can cite the reference in this datasheet.