제품 > 항체 > 다중클론항체(pAb)

GAP43 Rabbit pAb (A6376)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using GAP43 antibody (A6376) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - GAP43 Rabbit pAb (A6376)

Immunofluorescence analysis of Neuro-2a cells using GAP43 Rabbit pAb (A6376) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of SH-SY5Y cells using GAP43 Rabbit pAb (A6376) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	GAP43 Rabbit pAb
Catalog No.	A6376
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-238 of human GAP43 (NP_002036.1).
Sequence	MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Gene ID
Swiss Prot
Synonyms	B-50; PP46; GAP-43
Calculated MW	25kDa
Observed MW	43kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-251MG, Neuro-2a, Mouse heart, Rat brain
Cellular location	Cell junction, Cell membrane, Cell projection, Cytoplasmic side, Peripheral membrane protein, filopodium membrane, growth cone membrane, synapse
Customer validation	WB(Rattus norvegicus) IHC(Rattus norvegicus)