Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Western blot analysis of lysates from mouse heart, using CCNB1IP1 Rabbit pAb (A16693) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
| Product name | CCNB1IP1 Rabbit pAb |
|---|---|
| Catalog No. | A16693 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human CCNB1IP1 (NP_878269.1). |
|---|---|
| Sequence | MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HEI10; C14orf18; CCNB1IP1 |
| Calculated MW | 32kDa |
| Observed MW | 31kDa |
| Reactivity | Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | mouse heart |
| Cellular location | |
| Customer validation | IF(Mus musculus) WB(Sus scrofa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16693? Please let us know so that we can cite the reference in this datasheet.
