Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | CCNB1IP1 Rabbit pAb |
---|---|
Catalog No. | A16693 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human CCNB1IP1 (NP_878269.1). |
---|---|
Sequence | MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPA |
Gene ID | |
Swiss Prot | |
Synonyms | HEI10; C14orf18; CCNB1IP1 |
Calculated MW | 32kDa |
Observed MW | 31kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | mouse heart |
Cellular location | |
Customer validation | IF(Mus musculus) WB(Sus scrofa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16693? Please let us know so that we can cite the reference in this datasheet.