제품 > 항체 > 단일클론항체(mAb)

CCR6/CD196 Rabbit mAb (A26057)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with CCR6/CD196 Rabbit mAb (A26057, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CCR6/CD196 Rabbit mAb (A26057, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Flow cytometry: 1X10^6 NIH/3T3 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with CCR6/CD196 Rabbit mAb (A26057, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CCR6/CD196 Rabbit mAb (A26057, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	CCR6/CD196 Rabbit mAb
Catalog No.	A26057
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66559

Background

Enables C-C chemokine binding activity and C-C chemokine receptor activity. Involved in several processes, including immune system development; leukocyte migration; and regulation of cell motility. Located in external side of plasma membrane; sperm plasma membrane; and sperm principal piece. Is expressed in several structures, including central nervous system; gut; immune system; male reproductive gland or organ; and retina. Orthologous to human CCR6 (C-C motif chemokine receptor 6).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 2-38 of mouse CCR6/CD196 (NP_033965.1).
Sequence	NSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTK
Gene ID
Swiss Prot
Synonyms	CCR-6; KY411; Cmkbr6; CC-CKR-6
Calculated MW	42kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Multi-pass membrane protein, Cell surface