제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse CCR6/CD196 mAb (A26056)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with PE Rabbit anti-Mouse CCR6/CD196 mAb (A26056, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CCR6/CD196 mAb (A26056, 5 μl/Test, right).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CCR6/CD196 mAb (A26056, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse CCR6/CD196 mAb
Catalog No.	A26056
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66559-PE

Background

Enables C-C chemokine binding activity and C-C chemokine receptor activity. Involved in several processes, including immune system development; leukocyte migration; and regulation of cell motility. Located in external side of plasma membrane; sperm plasma membrane; and sperm principal piece. Is expressed in several structures, including central nervous system; gut; immune system; male reproductive gland or organ; and retina. Orthologous to human CCR6 (C-C motif chemokine receptor 6).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 2-38 of mouse CCR6/CD196 (NP_033965.1).
Sequence	NSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTK
Gene ID
Swiss Prot
Synonyms	CCR-6; KY411; Cmkbr6; CC-CKR-6
Calculated MW	42kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Multi-pass membrane protein, Cell surface.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Mouse CCR6/CD196 mAb images

Flow CytoMetry - PE Rabbit anti-Mouse CCR6/CD196 mAb (A26056)

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CCR6/CD196 mAb (A26056, 5 μl/Test, right).

Flow CytoMetry - PE Rabbit anti-Mouse CCR6/CD196 mAb (A26056)

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CCR6/CD196 mAb (A26056, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.