Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CCR6 Rabbit pAb |
---|---|
Catalog No. | A16206 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CCR6 (NP_004358.2). |
---|---|
Sequence | VTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM |
Gene ID | |
Swiss Prot | |
Synonyms | BN-1; DCR2; DRY6; CCR-6; CD196; CKRL3; GPR29; CKR-L3; CMKBR6; GPRCY4; STRL22; CC-CKR-6; C-C CKR-6; CCR6 |
Calculated MW | 42kDa |
Observed MW | 52kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | LO2 |
Cellular location | cell surface, external side of plasma membrane, plasma membrane, sperm flagellum, sperm plasma membrane |
Customer validation | WB(Anatinae) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16206? Please let us know so that we can cite the reference in this datasheet.