제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD196/CCR6 mAb (A27384)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with PE Rabbit anti-Human CD196/CCR6 mAb (A27384, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD196/CCR6 mAb (A27384, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD196/CCR6 mAb (A27384, 5 μl/Test, right). Cells in the Lymphocytes gate were used for analysis.

Overview

Product name	PE Rabbit anti-Human CD196/CCR6 mAb
Catalog No.	A27384
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64483-PE

Background

This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligand of this receptor is macrophage inflammatory protein 3 alpha (MIP-3 alpha). This receptor has been shown to be important for B-lineage maturation and antigen-driven B-cell differentiation, and it may regulate the migration and recruitment of dentritic and T cells during inflammatory and immunological responses. Alternatively spliced transcript variants that encode the same protein have been described for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-40 of human CD196/CCR6 (NP_004358.2).
Sequence	MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQE
Gene ID
Swiss Prot
Synonyms	BN-1; DCR2; DRY6; CCR-6; CD196; CKRL3; GPR29; CKR-L3; CMKBR6; GPRCY4; STRL22; CC-CKR-6; C-C CKR-6
Calculated MW	42kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	cell surface, external side of plasma membrane, plasma membrane, sperm flagellum, sperm plasma membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human CD196/CCR6 mAb images

Flow CytoMetry - PE Rabbit anti-Human CD196/CCR6 mAb (A27384)

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD196/CCR6 mAb (A27384, 5 μl/Test, right).

Flow CytoMetry - PE Rabbit anti-Human CD196/CCR6 mAb (A27384)

* For research use only. Not for therapeutic or diagnostic purposes.