Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CCR7 Rabbit pAb |
---|---|
Catalog No. | A14718 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 330-372 of human CCR7 (NP_001829.1). |
---|---|
Sequence | GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAET |
Gene ID | |
Swiss Prot | |
Synonyms | BLR2; EBI1; CCR-7; CD197; CDw197; CMKBR7; CC-CKR-7; CCR7 |
Calculated MW | 43kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | A-549, Mouse lung, Rat lung |
Cellular location | Cell membrane, Multi-pass membrane protein. |
Customer validation | WB(Rattus norvegicus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14718? Please let us know so that we can cite the reference in this datasheet.