제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD197/CCR7 mAb (A26833)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with PE Rabbit anti-Human CD197/CCR7 mAb (A26833, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD197/CCR7 mAb (A26833, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 488 Mouse anti-Human CD3 (A25188, 5 μl/Test) and PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD197/CCR7 mAb (A26833, 5 μl/Test, right). Cells in the lymphocyte gate were used for analysis.

Overview

Product name	PE Rabbit anti-Human CD197/CCR7 mAb
Catalog No.	A26833
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64945-PE

Background

The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-59 of human CD197/CCR7 (NP_001829.1).
Sequence	QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAW
Gene ID
Swiss Prot
Synonyms	BLR2; EBI1; CCR-7; CD197; CDw197; CMKBR7; CC-CKR-7
Calculated MW	43kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Multi-pass membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human CD197/CCR7 mAb images

Flow CytoMetry - PE Rabbit anti-Human CD197/CCR7 mAb (A26833)

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD197/CCR7 mAb (A26833, 5 μl/Test, right).

Flow CytoMetry - PE Rabbit anti-Human CD197/CCR7 mAb (A26833)

* For research use only. Not for therapeutic or diagnostic purposes.