Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CCR7 Rabbit mAb |
---|---|
Catalog No. | A0121 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0231 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248). |
---|---|
Sequence | MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL |
Gene ID | |
Swiss Prot | |
Synonyms | BLR2; EBI1; CCR-7; CD197; CDw197; CMKBR7; CC-CKR-7; CCR7 |
Calculated MW | 43kDa |
Observed MW | 43kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃.Avoid freeze/thaw cycles. Buffer:PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | A-549, Jurkat, C6, Mouse lung, Mouse spleen, Rat lung |
Cellular location | Cell membrane, Multi-pass membrane protein. |
Customer validation | IF(Rattus norvegicus, Mus musculus, Homo sapiens) WB(Homo sapiens, Rattus norvegicus) IF(Homo sapiens, Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0121? Please let us know so that we can cite the reference in this datasheet.