Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | IL1β Rabbit mAb |
---|---|
Catalog No. | A23484 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0114 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-269 of IL1β (NP_000567.1). |
---|---|
Sequence | DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Gene ID | |
Swiss Prot | |
Synonyms | IL-1; IL1F2; IL1beta; IL1-BETA; IL1β |
Calculated MW | 31kDa |
Observed MW | 35kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | THP-1 treated by LPS |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Lysosome, Secreted, autophagosome, cytosol, exosome. |
Customer validation | IHC(Homo sapiens) WB(Mus musculus , Homo sapiens, Rattus norvegicus) Other(Rattus norvegicus) IF(Mus musculus) ELISA(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23484? Please let us know so that we can cite the reference in this datasheet.