Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | IL6 Rabbit pAb |
---|---|
Catalog No. | A14687 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-212 of human IL6 (NP_000591.1). |
---|---|
Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Gene ID | |
Swiss Prot | |
Synonyms | CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2; IL6 |
Calculated MW | 24kDa |
Observed MW | 26kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | THP-1, Mouse spleen, Rat spleen |
Cellular location | Secreted. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Gallus gallus) IHC(Homo sapiens) IF(Rattus norvegicus) WB(Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14687? Please let us know so that we can cite the reference in this datasheet.