Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | IRF7 Rabbit pAb |
---|---|
Catalog No. | A0159 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2). |
---|---|
Sequence | KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP |
Gene ID | |
Swiss Prot | |
Synonyms | IMD39; IRF-7; IRF7A; IRF7B; IRF7C; IRF7H; IRF-7H; IRF7 |
Calculated MW | 54kDa |
Observed MW | 65kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Cynoglossus semilaevis, Mus musculus, Homo sapiens, Anatinae, Vaccinium myrtillus L) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0159? Please let us know so that we can cite the reference in this datasheet.