Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | IL6 Rabbit mAb |
---|---|
Catalog No. | A22222 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC5093-01 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-212 of human IL6 (NP_000591.1). |
---|---|
Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Gene ID | |
Swiss Prot | |
Synonyms | CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2; IL6 |
Calculated MW | 24kDa |
Observed MW | 24kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HUVEC |
Cellular location | Secreted. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus) IHC(Mus musculus) ELISA(Homo sapiens) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22222? Please let us know so that we can cite the reference in this datasheet.