Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | IL1β Rabbit mAb |
---|---|
Catalog No. | A23964 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53401 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 117-269 of human IL1β. (NP_000567.1). |
---|---|
Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Gene ID | |
Swiss Prot | |
Synonyms | IL-1; IL1F2; IL1beta; IL1-BETA; IL1β |
Calculated MW | 31kDa |
Observed MW | 31kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87 MG |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Lysosome, Secreted, autophagosome, cytosol, exosome |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23964? Please let us know so that we can cite the reference in this datasheet.