제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human IL-1β mAb (A24244)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells(negative control, left) and 293T (Transfection, right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human IL-1β mAb(A24244, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T cells (negative control) were intracellularly-stained with ABflo® 488 Rabbit anti-Human IL-1β mAb(A24244, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained 293T cells were used as blank control (red line).

Flow cytometry:1X10^6 293T(Transfection) cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human IL-1β mAb(A24244, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human IL-1β mAb
Catalog No.	A24244
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53391-ABflo488

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 117-269 of human IL1β (NP_000567.1).
Sequence	APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Gene ID
Swiss Prot
Synonyms	IL1B; IL-1; IL1-BETA; IL1F2; interleukin-1 beta
Calculated MW	30kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cytoplasm, Cytoplasmic vesicle, Lysosome, Secreted, autophagosome, cytosol, exosome.