제품 > 항체 > 다중클론항체(pAb)

CCL3 Rabbit pAb (A7568)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from THP-1 cells, using CCL3 Rabbit pAb (A7568) at 1:1000 dilution. THP-1 cells were treated by LPS for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Review

Overview

Product name	CCL3 Rabbit pAb
Catalog No.	A7568
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 24-92 of human CCL3 (NP_002974.1).
Sequence	SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Gene ID
Swiss Prot
Synonyms	MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha; CCL3
Calculated MW	10kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	THP-1 treated by LPS and Brefeldin A
Cellular location	Secreted.
Customer validation	(Human breast cancer) IHC(Rattus norvegicus, Homo sapiens, Mus musculus) WB(Rattus norvegicus) IF(Rattus norvegicus)