Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of lysates from NIH/3T3 cells, using MDM2 Rabbit pAb (A0345) at 1:1000 dilution. NIH/3T3 cells were treated by MG132(50 μM) at 37℃ for 90 minutes.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
| Product name | MDM2 Rabbit pAb |
|---|---|
| Catalog No. | A0345 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 231-330 of human MDM2 (NP_001354919.1). |
|---|---|
| Sequence | HSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HDMX; LSKB; hdm2; ACTFS; MDM2 |
| Calculated MW | 55kDa |
| Observed MW | 90kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | NIH/3T3 treated by MG132 |
| Cellular location | Cytoplasm, Nucleus, nucleolus, nucleoplasm. |
| Customer validation | WB(Homo sapiens, Mus musculus, Mus musculus) IHC(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0345? Please let us know so that we can cite the reference in this datasheet.
