제품 > 항체 > 단일클론항체(mAb)

MDM2 Rabbit mAb (A23387)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using MDM2 Rabbit mAb (A23387) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	MDM2 Rabbit mAb
Catalog No.	A23387
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60294

Background

This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 101-200 of human MDM2 (NP_001354919.1).
Sequence	TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Gene ID
Swiss Prot
Synonyms	HDMX; LSKB; hdm2; ACTFS; MDM2
Calculated MW	55kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples	U2OS+Nutlin 3a
Cellular location	Cytoplasm, Nucleus, nucleolus, nucleoplasm.