제품 > 항체 > 단일클론항체(mAb)

MDM2 Rabbit mAb (A23388)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from U2OS cells, using MDM2 Rabbit mAb (A23388) at 1:2000 dilution. U2OS cells were treated by Nutlin 3a(10μM ) at 37℃ for 24 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	MDM2 Rabbit mAb
Catalog No.	A23388
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60296

Background

This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 101-200 of human MDM2 (NP_001354919.1).
Sequence	TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Gene ID
Swiss Prot
Synonyms	HDMX; LSKB; hdm2; ACTFS; MDM2
Calculated MW	11kDa/14kDa/24kDa/30kDa/33kDa/35kDa/48kDa/49kDa/55kDa
Observed MW	90kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U2OS treated by Nutlin 3a
Cellular location	Cytoplasm, Nucleus, nucleolus, nucleoplasm.