제품 > 항체 > 단일클론항체(mAb)

CD116/GM-CSFRα Rabbit mAb (A25547)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CD116/GM-CSFRα Rabbit mAb (A25547) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): 293T.
Exposure time: 90s.

ABclonal:Flow CytoMetry - CD116/GM-CSFRα Rabbit mAb (A25547)

Flow cytometry: 1X10^6 293F cells (negative control, left) and BeWo cells (right) were surface-stained with CD116/GM-CSFRα Rabbit mAb (A25547, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 BeWo cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD116/GM-CSFRα Rabbit mAb (A25547, 2 μg/mL, right), followed by FITC conjugated goat anti-Rabbit pAb staining.

Overview

Product name	CD116/GM-CSFRα Rabbit mAb
Catalog No.	A25547
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59275

Background

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-320 of human CD116/GM-CSFRα (NP_006131.2).
Sequence	EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Gene ID
Swiss Prot
Synonyms	GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha; CD116/GM-CSFRα
Calculated MW	27kDa/33kDa/38kDa/44kDa/46kDa/50kDa
Observed MW	70-80kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	BeWo
Cellular location	secreted, Cell membrane, Secreted, Single-pass type I membrane protein.