제품 > 항체 > 단일클론항체(mAb)

CD127/IL7R Rabbit mAb (A11678)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CD127/IL7R Rabbit mAb (A11678) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CD127/IL7R Rabbit mAb (A11678)

Confocal imaging of human spleen using CD127/IL7R Rabbit mAb (A11678, at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Confocal imaging of mouse spleen using CD127/IL7R Rabbit mAb (A11678, at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Review

Overview

Product name	CD127/IL7R Rabbit mAb
Catalog No.	A11678
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0672

Background

The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD127/IL7R (P16871).
Sequence	PESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHV
Gene ID
Swiss Prot
Synonyms	ILRA; CD127; IL7RA; CDW127; IMD104; sIL-7R; lnc-IL7R; IL7Ralpha; IL-7Ralpha; IL-7R-alpha; CD127/IL7R
Calculated MW	52kDa
Observed MW	72kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Hep G2, PC-3, Mouse liver, Mouse thymus
Cellular location	Cell membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein.
Customer validation	(Isolated Eosinophils)