제품 > 항체 > 단일클론항체(mAb)

CD30 Rabbit mAb (A21230)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of paraffin-embedded Human anaplastic large cell lymphoma using CD30 Rabbit mAb (A21230) at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using CD30 Rabbit mAb (A21230) at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - CD30 Rabbit mAb (A21230)

Confocal imaging of K-562 cells using CD30 Rabbit mAb (A21230, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

ABclonal:Flow CytoMetry - CD30 Rabbit mAb (A21230)

Flow cytometry: 1X10^6 A549 cells (negative control, left) and K-562 cells (right) were surface-stained with CD30 Rabbit mAb (A21230, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line), followed by Alexa Fluor®647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	CD30 Rabbit mAb
Catalog No.	A21230
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52949

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3).
Sequence	FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Gene ID
Swiss Prot
Synonyms	CD30; Ki-1; D1S166E
Calculated MW	14kDa/50kDa/63kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200 FC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Cell membrane, Cytoplasm, Single-pass type I membrane protein.