제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD30 mAb (A26396)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 A549 cells (negative control, left) and K-562 cells (right) were surface-stained with PE Rabbit anti-Human CD30 mAb (A26396, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 K-562 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD30 mAb (A26396, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human CD30 mAb
Catalog No.	A26396
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52955-PE

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3).
Sequence	FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Gene ID
Swiss Prot
Synonyms	CD30; Ki-1; D1S166E
Calculated MW	14kDa/50kDa/63kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cytoplasm, Extracellular exosome, Plasma membrane, Cell membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human CD30 mAb images

Flow CytoMetry - PE Rabbit anti-Human CD30 mAb (A26396)

Flow cytometry: 1X10^6 K-562 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD30 mAb (A26396, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.