제품 > 항체 > 다중클론항체(pAb)

CD47 Rabbit pAb (A23052)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from Mouse thymus, using CD47 Rabbit pAb (A23052) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of various lysates, using CD47 Rabbit pAb (A23052) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	CD47 Rabbit pAb
Catalog No.	A23052
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion and thrombospondin receptor activity. Involved in regulation of nitric oxide biosynthetic process. Acts upstream of or within several processes, including monocyte aggregation; opsonization; and positive regulation of phagocytosis. Located in extracellular exosome. Is integral component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD47 (CD47 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of mouse CD47. (NP_034711.1).
Sequence	QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNT
Gene ID
Swiss Prot
Synonyms	IAP; Itgp; 9130415E20Rik; B430305P08Rik; CD47
Calculated MW	33kDa
Observed MW	45-60kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse thymus, Rat spleen, Rat lung
Cellular location
Customer validation	FC(Mus musculus) WB(Mus musculus)