제품 > 항체 > 단일클론항체(mAb)

CD69 Rabbit mAb (A22171)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from Rat spleen, using CD69 Rabbit mAb (A22171) at1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CD69 Rabbit mAb (A22171)

Immunofluorescence analysis of paraffin-embedded mouse spleen using CD69 Rabbit mAb (A22171) at dilution of 1:200(40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded rat spleen using CD69 Rabbit mAb (A22171) at dilution of 1:200(40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CD69 Rabbit mAb
Catalog No.	A22171
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56158

Background

This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 62-199 of human CD69 (NP_001772.1).
Sequence	SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Gene ID
Swiss Prot
Synonyms	AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26; CD69
Calculated MW	23kDa
Observed MW	25-45kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:4000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat spleen
Cellular location	Membrane, Single-pass type II membrane protein