제품 > 항체 > 단일클론항체(mAb)

CD69 Rabbit mAb (A25959)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with CD69 Rabbit mAb (A25959, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD69 Rabbit mAb (A25959, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	CD69 Rabbit mAb
Catalog No.	A25959
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68505

Background

This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 78-199 of human CD69 (NP_001772.1).
Sequence	SDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Gene ID
Swiss Prot
Synonyms	AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26
Calculated MW	23kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type II membrane protein