제품 > 항체 > 단일클론항체(mAb)

CD93 Rabbit mAb (A26060)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Confocal imaging of 293T cells transfected with CD93 using CD93 Rabbit mAb (A26060, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - CD93 Rabbit mAb (A26060)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with CD93 Rabbit mAb (A26060, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse bone marrow cells were surface-stained with CD93 Rabbit mAb (A26060, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb. Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	CD93 Rabbit mAb
Catalog No.	A26060
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67562

Background

Predicted to enable complement component C1q complex binding activity. Predicted to be involved in cell-cell adhesion. Predicted to act upstream of or within cell adhesion. Located in cell surface; cytoplasmic vesicle; and plasma membrane. Is expressed in blood vessel. Orthologous to human CD93 (CD93 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-181 of mouse CD93 (NP_034870.1).
Sequence	ADSQAVVCEGTACYTAHWGKLSAAEAQHRCNENGGNLATVKSEEEARHVQQALTQLLKTKAPLEAKMGKFWIGLQREKGNCTYHDLPMRGFSWVGGGEDTAYSNWYKASKSSCIFKRCVSLILDLSLTPHPSHLPKWHESPCGTPEAPGNSIEGFLCKF
Gene ID
Swiss Prot
Synonyms	Ly68; AA4.1; C1qr1; C1qrp; 6030404G09Rik
Calculated MW	69kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Membrane ; Single-pass type I membrane protein