Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates using CDK1/2 Rabbit PolymAb® (A26696PM) at 1:3000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using CDK1/2 Rabbit PolymAb® (A26696PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using CDK1/2 Rabbit PolymAb® (A26696PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue tissue using CDK1/2 Rabbit PolymAb® (A26696PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CDK1/2 Rabbit PolymAb® (A26696PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using CDK1/2 Rabbit PolymAb® (A26696PM) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using CDK1/2 Rabbit PolymAb® (A26696PM) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using CDK1/2 Rabbit PolymAb® (A26696PM) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Human colon tissue using CDK1/2 Rabbit PolymAb® (A26696PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
| Product name | CDK1/2 Rabbit PolymAb® |
|---|---|
| Catalog No. | A26696PM |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 199-298 of human CDK1/2 (P24941). |
|---|---|
| Sequence | RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CDC2; CDC28A; P34CDC2; CDKN2; p33(CDK2) |
| Calculated MW | 34kDa |
| Observed MW | 33kDa/34kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | 293T, Jurkat |
| Cellular location | Cajal body, Cytoplasm, Endosome, Nucleus, centrosome, cytoskeleton, microtubule organizing center. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
