Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | CDK6 Rabbit mAb |
---|---|
Catalog No. | A0106 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0224 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 227-326 of human CDK6 (Q00534). |
---|---|
Sequence | QLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA |
Gene ID | |
Swiss Prot | |
Synonyms | MCPH12; PLSTIRE |
Calculated MW | 37kDa |
Observed MW | 37kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, C6, HeLa |
Cellular location | Cell projection, Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, ruffle |
Customer validation | WB(Homo sapiens, Mus musculus) RT-qPCR(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0106? Please let us know so that we can cite the reference in this datasheet.