Review (2)Publications (13) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CDK6 Rabbit pAb |
---|---|
Catalog No. | A1545 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 226-326 of human CDK6 (NP_001250.1). |
---|---|
Sequence | DQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA |
Gene ID | |
Swiss Prot | |
Synonyms | MCPH12; PLSTIRE; CDK6 |
Calculated MW | 37kDa |
Observed MW | 40kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa |
Cellular location | Cell projection, Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, ruffle. |
Customer validation | (HCT116, HepG2) WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A1545? Please let us know so that we can cite the reference in this datasheet.