제품 > 항체 > 단일클론항체(mAb)

CHMP2B Rabbit mAb (A19244)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CHMP2B Rabbit mAb (A19244) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - CHMP2B Rabbit mAb (A19244)

Immunohistochemistry analysis of paraffin-embedded mouse testis using CHMP2B Rabbit mAb (A19244) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	CHMP2B Rabbit mAb
Catalog No.	A19244
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2404

Background

This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 114-213 of human CHMP2B (Q9UQN3).
Sequence	KKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Gene ID
Swiss Prot
Synonyms	DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5; FTDALS7; CHMP2B
Calculated MW	24kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, PC-12, C2C12, RD, SH-SY5Y, Mouse brain
Cellular location	Cytoplasm, Late endosome membrane, Peripheral membrane protein, Cytosol
Customer validation	IHC(Homo sapiens)