제품 > 항체 > 단일클론항체(mAb)

CLEC3B/Tetranectin Rabbit mAb (A4387)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (A4387) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - CLEC3B/Tetranectin Rabbit mAb (A4387)

Immunofluorescence analysis of C6 cells using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (A4387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (A4387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	CLEC3B/Tetranectin Rabbit mAb
Catalog No.	A4387
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0993

Background

Enables calcium ion binding activity; heparin binding activity; and kringle domain binding activity. Involved in bone mineralization and cellular response to transforming growth factor beta stimulus. Located in cytoplasm; extracellular space; and granular component. Part of collagen-containing extracellular matrix. Implicated in osteoarthritis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 103-202 of human CLEC3B/Tetranectin (P05452).
Sequence	GTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Gene ID
Swiss Prot
Synonyms	TN; TNA; MCDR4
Calculated MW	21kDa
Observed MW	23-25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Human plasma, Mouse lung, Rat lung
Cellular location	Secreted
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CLEC3B/Tetranectin Rabbit mAb images

Western blot - CLEC3B/Tetranectin Rabbit mAb (A4387)

Immunofluorescence - CLEC3B/Tetranectin Rabbit mAb (A4387)

Immunofluorescence analysis of C6 cells using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (A4387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - CLEC3B/Tetranectin Rabbit mAb (A4387)

Immunofluorescence analysis of NIH-3T3 cells using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (A4387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.