CLEC3B/Tetranectin Rabbit pAb (A6418)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - CLEC3B/Tetranectin Rabbit pAb (A6418)

Immunofluorescence analysis of HeLa cells using CLEC3B/Tetranectin antibody (A6418). Blue: DAPI for nuclear staining.

Overview

Product name	CLEC3B/Tetranectin Rabbit pAb
Catalog No.	A6418
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Enables calcium ion binding activity; heparin binding activity; and kringle domain binding activity. Involved in bone mineralization and cellular response to transforming growth factor beta stimulus. Located in cytoplasm; extracellular space; and granular component. Part of collagen-containing extracellular matrix. Implicated in osteoarthritis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-202 of human CLEC3B/Tetranectin (NP_003269.2).
Sequence	EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Gene ID
Swiss Prot
Synonyms	TN; TNA; MCDR4
Calculated MW	21kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:10 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Secreted