제품 > 항체 > 다중클론항체(pAb)

CLIC1 Rabbit pAb (A13684)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CLIC1 antibody (A13684) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - CLIC1 Rabbit pAb (A13684)

Immunofluorescence analysis of C2C12 cells using CLIC1 Rabbit pAb (A13684) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 cells using CLIC1 Rabbit pAb (A13684) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of K-562 cells using CLIC1 Rabbit pAb (A13684) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using CLIC1 Rabbit pAb (A13684) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of THP-1 cells using CLIC1 Rabbit pAb (A13684) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	CLIC1 Rabbit pAb
Catalog No.	A13684
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 42-241 of human CLIC1 (NP_001279.2).
Sequence	NVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Gene ID
Swiss Prot
Synonyms	G6; CL1C1; NCC27; CLCNL1
Calculated MW	27kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Jurkat, HeLa, HepG2, Rat kidney
Cellular location	Cell membrane, Cytoplasm, Nucleus, Nucleus membrane, Single-pass membrane protein