제품 > 항체 > 다중클론항체(pAb)

CLIC1 Rabbit pAb (A6363)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CLIC1 Rabbit pAb (A6363) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	CLIC1 Rabbit pAb
Catalog No.	A6363
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 42-241 of human CLIC1 (NP_001279.2).
Sequence	NVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Gene ID
Swiss Prot
Synonyms	G6; CL1C1; NCC27; CLCNL1; CLIC1
Calculated MW	27kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	MCF7, Jurkat, HeLa, HepG2, Mouse kidney, Mouse lung, Rat kidney
Cellular location	Cell membrane, Cytoplasm, Nucleus, Nucleus membrane, Single-pass membrane protein.
Customer validation	WB(Mus musculus, Homo sapiens)