제품 > 항체 > 단일클론항체(mAb)

CLIC4 Rabbit mAb (A21149)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using CLIC4 Rabbit mAb (A21149) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	CLIC4 Rabbit mAb
Catalog No.	A21149
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2998

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CLIC4 (NP_039234.1).
Sequence	MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC
Gene ID
Swiss Prot
Synonyms	H1; huH1; p64H1; CLIC4L; MTCLIC; CLIC4
Calculated MW	29kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, SW620, HepG2, Mouse lung, Mouse kidney, Rat lung, Rat brain
Cellular location	Cell junction, Cell membrane, Cytoplasm, Cytoplasmic vesicle membrane, Mitochondrion, Nucleus matrix, Single-pass membrane protein, centrosome, cytoskeleton, microtubule organizing center
Customer validation	WB(Mus musculus)