제품 > 항체 > 다중클론항체(pAb)

CLIC4 Rabbit pAb (A7088)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CLIC4 Rabbit pAb (A7088) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - CLIC4 Rabbit pAb (A7088)

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using CLIC4 Rabbit pAb (A7088) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using CLIC4 Rabbit pAb (A7088) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using CLIC4 Rabbit pAb (A7088) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CLIC4 Rabbit pAb (A7088)

Immunofluorescence analysis of A-549 cells using CLIC4 Rabbit pAb (A7088). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CLIC4 Rabbit pAb
Catalog No.	A7088
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-253 of human CLIC4 (NP_039234.1).
Sequence	MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Gene ID
Swiss Prot
Synonyms	H1; huH1; p64H1; CLIC4L; MTCLIC; CLIC4
Calculated MW	29kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	SW620, Mouse kidney, Rat brain, Rat kidney
Cellular location	Cell junction, Cell membrane, Cytoplasm, Cytoplasmic vesicle membrane, Mitochondrion, Nucleus matrix, Single-pass membrane protein, centrosome, cytoskeleton, microtubule organizing center
Customer validation	WB(Homo sapiens, Mus musculus) IF(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구내분비 & 대사미토콘드리아 대사미토콘드리아 마커

CLIC4 Rabbit pAb images

Western blot - CLIC4 Rabbit pAb (A7088)

Immunohistochemistry - CLIC4 Rabbit pAb (A7088)

Immunofluorescence - CLIC4 Rabbit pAb (A7088)

Immunofluorescence analysis of A-549 cells using CLIC4 Rabbit pAb (A7088). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.