제품 > 항체 > 다중클론항체(pAb)

CREB1 Rabbit pAb (A1189)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CREB1 Rabbit pAb (A1189) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunoprecipitation - CREB1 Rabbit pAb (A1189)

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 1 μg CREB1 antibody (A1189). Western blot was performed from the immunoprecipitate using CREB1 antibody (A1189) at a dilution of 1:1000.

Review

Overview

Product name	CREB1 Rabbit pAb
Catalog No.	A1189
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CREB1 (NP_604391.1).
Sequence	MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
Gene ID
Swiss Prot
Synonyms	CREB; CREB-1; CREB1
Calculated MW	35kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, PC-3, 293T, MCF-7, Mouse brain
Cellular location	Nucleus.
Customer validation	(Human,Mouse,Rat) WB(Homo sapiens, Mus musculus)