제품 > 항체 > 단일클론항체(mAb)

CRM1/XPO1 Rabbit mAb (A19625)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from mouse lung, using CRM1/XPO1 Rabbit mAb (A19625) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of various lysates using CRM1/XPO1 Rabbit mAb (A19625) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CRM1/XPO1 Rabbit mAb (A19625)

Immunofluorescence analysis of C6 cells using CRM1/XPO1 Rabbit mAb (A19625). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using CRM1/XPO1 Rabbit mAb (A19625). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using CRM1/XPO1 Rabbit mAb (A19625). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	CRM1/XPO1 Rabbit mAb
Catalog No.	A19625
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0104

Background

This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 972-1071 of human CRM1/XPO1 (O14980).
Sequence	IFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
Gene ID
Swiss Prot
Synonyms	emb; CRM1; exp1; CRM-1; Exportin 1; CRM1/XPO1
Calculated MW	123kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U2OS, MCF7, HeLa, Mouse thymus, Mouse lung
Cellular location	Cajal body, Cytoplasm, Nucleus, nucleolus, nucleoplasm.
Customer validation	(MOLT-4、MCF-7) IHC(Homo sapiens) Co-IP(Homo sapiens) Other(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구세포 생물학 & 발달 생물학세포주기중심체

CRM1/XPO1 Rabbit mAb images

Western blot - CRM1/XPO1 Rabbit mAb (A19625)

Immunofluorescence - CRM1/XPO1 Rabbit mAb (A19625)

Immunofluorescence analysis of C6 cells using CRM1/XPO1 Rabbit mAb (A19625). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence - CRM1/XPO1 Rabbit mAb (A19625)

* For research use only. Not for therapeutic or diagnostic purposes.