제품 > 항체 > 다중클론항체(pAb)

CRM1/XPO1 Rabbit pAb (A0299)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using CRM1/XPO1 Rabbit pAb (A0299) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	CRM1/XPO1 Rabbit pAb
Catalog No.	A0299
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 964-1064 of human CRM1/CRM1/XPO1 (NP_003391.1).
Sequence	PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE
Gene ID
Swiss Prot
Synonyms	emb; CRM1; exp1; CRM-1; CRM1/XPO1
Calculated MW	123kDa
Observed MW	123kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, MCF7, RAW264.7, U-251MG
Cellular location	Cajal body, Cytoplasm, Nucleus, nucleolus, nucleoplasm.
Customer validation	WB(Homo sapiens) Co-IP(Other) IHC(Other)